PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Lsa001517
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Asterales; Asteraceae; Cichorioideae; Cichorieae; Lactucinae; Lactuca
Family HD-ZIP
Protein Properties Length: 341aa    MW: 38446.3 Da    PI: 7.7868
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-187a-Lactuca_sativa-2746PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox58.51.1e-18223277256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ ++tkeq   Le+ F+++++++ ++++ LAk+l+L  rqV vWFqNrRa+ k
  Lsa001517 223 RKKLRLTKEQSAFLEDSFKEHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTK 277
                788899***********************************************98 PP

2HD-ZIP_I/II127.65.2e-41223313192
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeenerLekeveeLreelk 92 
                  +kk+rl+keq+++LE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr++++l+een+rL+ke +eLr +lk
    Lsa001517 223 RKKLRLTKEQSAFLEDSFKEHSTLNPKQKQALAKQLNLRPRQVEVWFQNRRARTKLKQTEVDCEYLKRCCETLTEENRRLQKELQELR-ALK 313
                  69*************************************************************************************9.555 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.77E-19211280IPR009057Homeodomain-like
PROSITE profilePS5007117.103219279IPR001356Homeobox domain
SMARTSM003897.9E-16221283IPR001356Homeobox domain
CDDcd000861.25E-15223280No hitNo description
Gene3DG3DSA:1.10.10.607.7E-18223277IPR009057Homeodomain-like
PfamPF000464.4E-16223277IPR001356Homeobox domain
PROSITE patternPS000270254277IPR017970Homeobox, conserved site
SMARTSM003401.1E-26279322IPR003106Leucine zipper, homeobox-associated
PfamPF021836.9E-11279313IPR003106Leucine zipper, homeobox-associated
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 341 aa     Download sequence    Send to blast
MELALSLGDT PKPFSLLDHH SRSQQQKMKD LGFCMGLGGS KNLEVELNFK NMMREKDDDD  60
AHRKSEEKRS SSSSSDPSPP PPPLQLDLLP FSPVLRSAPP PTPSHRSFPW LSKNLITEMG  120
SQNKAVQVLD VKPLAVVSDQ ENMEETAGGE SSPNNSNSGT SSFQMDFSTI FKSSNCGRSF  180
HSRKRDLDLA TVNLELIEAT ESDQRASSRG GGMSDEDENG LTRKKLRLTK EQSAFLEDSF  240
KEHSTLNPKQ KQALAKQLNL RPRQVEVWFQ NRRARTKLKQ TEVDCEYLKR CCETLTEENR  300
RLQKELQELR ALKTSQPFYM QMPATTLTMC PSCERVATTT T
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1221227TRKKLRL
2271279RRARTKLKQ
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002322729.21e-118hypothetical protein POPTR_0016s05890g
SwissprotP466653e-91HAT14_ARATH; Homeobox-leucine zipper protein HAT14
TrEMBLA0A118K1W81e-171A0A118K1W8_CYNCS; Homeobox, conserved site-containing protein
STRINGPOPTR_0016s05890.11e-117(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06710.15e-87homeobox from Arabidopsis thaliana